KEGG   Pseudomonas sp. ATCC 13867: H681_21040
Entry
H681_21040        CDS       T02524                                 
Name
(GenBank) polynucleotide phosphorylase/polyadenylase
  KO
K00962  polyribonucleotide nucleotidyltransferase [EC:2.7.7.8]
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    H681_21040
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pdr03019]
    H681_21040
   03016 Transfer RNA biogenesis [BR:pdr03016]
    H681_21040
Enzymes [BR:pdr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.8  polyribonucleotide nucleotidyltransferase
     H681_21040
Messenger RNA biogenesis [BR:pdr03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     H681_21040
Transfer RNA biogenesis [BR:pdr03016]
 Prokaryotic type
  tRNA degradation factors
   H681_21040
SSDB
Motif
Pfam: RNase_PH PNPase RNase_PH_C S1 KH_1 S1_2 KH_2
Other DBs
NCBI-ProteinID: AGI26075
UniProt: M4XLD8
LinkDB
Position
complement(4711404..4713509)
AA seq 701 aa
MNPVTKKFQFGQSTVTLETGRIARQATGAVLVTMDDVTVLCTVVGAKQADPSKSFFPLSV
HYQEKTYAAGRIPGGFFKREGRPSEKETLTSRLIDRPIRPLFPEGFMNEVQVVCTVVSTN
KKSDPDIAAMIGTSAALAISGIPFAGPIGAARVGFHPEIGYILNPTYEQQQSSSLDMVVA
GTSDAVLMVESEADELTEDQMLGAVLFAHEEFQAVIRAVAELATEAGKPSWNWTAPVENT
ALVNTIKAEFGAAISEAYTVTVKQDRYAALDALREQIVAKFAGEGEGQFSAGEVKDVFGL
LEYRTVRENIVNGKPRIDGRDTRTVRPLRIEVGVLGKTHGSALFTRGETQALVVATLGTA
RDAQLLDTLEGERKDPFMLHYNFPPFSVGECGRMGSAGRREIGHGRLARRSVAAMLPTQD
EFPYTIRVVSEITESNGSSSMASVCGASLALMDAGVPVKAPVAGIAMGLVKEGDKFAILT
DILGDEDHLGDMDFKVAGTDKGVTALQMDIKINGITEEIMEIALGQALEARLNILGQMNQ
IIAAPRAELSENAPTMIQMKIDTDKIRDVIGKGGATIRSICEETKASIDIEDDGSVKIYG
ETKEAAEAAKQRVLGITAEAEIGKIYVGKVERIVDFGAFVNILPGKDGLVHISQISDKRI
DKVTDVLQEGQEVKVLVLDVDNRGRIKLSIKDVAAAEASGV
NT seq 2106 nt   +upstreamnt  +downstreamnt
gtgaacccggtaaccaagaaattccagttcggtcagtcgaccgtaaccctcgagactggc
cgcatcgcccgccaggccaccggtgccgtcctggtcaccatggacgacgtcaccgtgctc
tgcaccgtcgtcggcgccaagcaggccgacccgagcaagagcttcttcccgctctccgtg
cactaccaggagaagacctacgcagccggccgcatccccggtggtttcttcaagcgtgaa
ggccgtccttccgagaaggaaaccctgacctcgcgcctgatcgaccgtccgatccgcccg
ctgttcccggaaggcttcatgaacgaagtgcaggttgtctgcaccgtcgtttccaccaac
aagaagtccgatccggacatcgctgccatgatcggcacctccgccgccctggcgatctcc
ggcattccgttcgccggcccgatcggcgctgcccgcgttggcttccacccggaaattggc
tacatcctcaacccgacctacgagcagcagcagagctccagcctcgacatggtcgtggcc
ggtacttccgatgccgtgttgatggttgaatccgaagccgacgagctgaccgaagaccag
atgctgggcgccgttctgttcgcccacgaagaattccaggcggtcatccgcgccgttgcc
gaactggcaaccgaagccggtaagccgagttggaactggaccgcgccggtcgagaacacc
gccctggtcaacaccatcaaggccgagttcggtgctgccatctccgaggcctacaccgtt
accgtcaagcaggaccgttacgcggccctggacgccctgcgcgagcagatcgtcgccaag
ttcgccggcgaaggcgaaggccagttctccgcgggtgaagtcaaagacgtcttcggcctg
ctggaataccgcaccgttcgcgagaacatcgtcaacggcaaaccgcgtatcgacggccgc
gacacccgcaccgttcgtccgctgcgtatcgaagtcggcgtactgggcaagacccacggt
tcggcgctgttcacccgtggcgaaacccaggccctggtcgttgccaccctcggcaccgcc
cgtgacgcccaactgctcgacaccctcgaaggcgagcgcaaagaccccttcatgctgcac
tacaacttcccgccgttctcggtgggcgagtgtggccgcatgggcagcgctggccgtcgt
gaaatcggccacggccgtctggcccgtcgcagcgtcgctgccatgctgccgacccaggac
gagttcccctacaccatccgtgtggtttccgagatcaccgaatccaatggctccagttcc
atggcgtcggtctgtggtgcttccctggcgctgatggatgccggtgttccggtcaaggcg
ccggttgccggtatcgccatgggtctggtgaaggaaggtgacaagttcgccatcctgacc
gacatcctgggtgatgaagaccacctgggcgacatggacttcaaggttgccggtaccgac
aagggtgttaccgccctgcagatggacatcaagatcaacggcatcaccgaagagatcatg
gagatcgccctgggccaggccctggaagctcgcctgaacatcctcggccagatgaaccag
atcatcgccgctccgcgcgccgagctgtcggaaaacgctccgaccatgatccagatgaag
atcgacaccgacaagatccgcgacgtcatcggcaagggcggcgccaccattcgcagcatc
tgcgaagagaccaaggcctcgatcgacatcgaggacgatggcagcgtgaagatctacggc
gaaaccaaggaagctgccgaggccgccaagcagcgcgtcctgggtatcaccgcggaagcc
gagatcggcaagatctacgtcggcaaggtcgagcgcatcgtcgacttcggcgccttcgtc
aacatcctgccgggcaaggacggtctggtgcacatctcgcagatcagcgacaagcgcatc
gacaaggtcaccgacgttctgcaggaaggccaggaagtcaaagtcctggtcctcgacgtg
gacaaccgtggccgcatcaagctgtccatcaaggacgtagccgctgctgaagcctccggc
gtgtaa

DBGET integrated database retrieval system