KEGG   Pseudomonas sp. ATCC 13867: H681_23550
Entry
H681_23550        CDS       T02524                                 
Name
(GenBank) RNA pyrophosphohydrolase
  KO
K08311  putative (di)nucleoside polyphosphate hydrolase [EC:3.6.1.-]
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    H681_23550
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pdr03019]
    H681_23550
Enzymes [BR:pdr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-
     H681_23550
Messenger RNA biogenesis [BR:pdr03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Others
     H681_23550
SSDB
Motif
Pfam: NUDIX NUDIX_2 NUDIX_4
Other DBs
NCBI-ProteinID: AGI26577
UniProt: M4X683
LinkDB
Position
complement(5282072..5282551)
AA seq 159 aa
MIDPDGFRPNVGIILCNDVGQVLWARRINQEAWQFPQGGINARETPEEALFRELNEEVGL
EEQDVRILACTRGWLRYRLPQRLVRTNSQPLCIGQKQKWFLLRLTGEESRVRMDVTGKPE
FDGWRWVSYWYPLGQVVTFKREVYRRALKELAPRLLARD
NT seq 480 nt   +upstreamnt  +downstreamnt
gtgatcgatcccgatggttttcgccccaatgtcggcatcatcctttgcaacgatgtcgga
caggtactgtgggcacggcgaatcaaccaggaagcctggcaatttccccagggtggcatc
aacgcccgcgaaacccctgaggaagcgctgttccgcgaattgaacgaagaagtcggcctg
gaggaacaggacgtacggattcttgcctgtacccgtggctggctgcgttaccgcctgccg
caacgcctggttcggaccaacagccaaccgctgtgcatcgggcagaagcagaaatggttc
ctcctgcgcctgaccggcgaggaaagccgggtgcgcatggatgtgaccggcaaaccggag
ttcgacggctggcgctgggtcagctactggtacccgctcggccaggtcgtgaccttcaaa
cgcgaggtctaccgccgggccctgaaggaattggcaccgcgcctcctggcgcgcgactag

DBGET integrated database retrieval system