KEGG   Prevotella dentalis: Prede_0975
Entry
Prede_0975        CDS       T02403                                 
Name
(GenBank) cysteine synthase A
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Organism
pdt  Prevotella dentalis
Pathway
pdt00270  Cysteine and methionine metabolism
pdt00920  Sulfur metabolism
pdt01100  Metabolic pathways
pdt01110  Biosynthesis of secondary metabolites
pdt01120  Microbial metabolism in diverse environments
pdt01200  Carbon metabolism
pdt01230  Biosynthesis of amino acids
Module
pdt_M00021  Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:pdt00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Prede_0975
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Prede_0975
Enzymes [BR:pdt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     Prede_0975
SSDB
Motif
Pfam: PALP DUF6351 GCV_T_C
Other DBs
NCBI-ProteinID: AGB28316
UniProt: F9D1W1
LinkDB
Position
1:complement(1188617..1189564)
AA seq 315 aa
MAKIFKRITDLVGRTPLVELAKYSALRGAGTPVVAKVESFNPGGSVKDRIALAMIEAAEA
QGLLKPGATIIEPTSGNTGVGLALVSAVKGYKLILTMPETMSMERRNLVKAYGAQVKLTS
GAAGMGGAIKAAEELRDSIPGSIILGQFVNQANPQRHYDTTGLEIWEDTDGQVDIFVAGV
GTGGTVSGIGRRLKEKNPGVKIVAVEPSASPVLSGGTAGPHKIQGIGAGFVPATYDASVV
DEVVRVDNDDAILAGRQLAQQEGLLVGISSGAAAFAATELARRPENAGKRIVVLLPDTGE
RYLSTVLYAFDEYPL
NT seq 948 nt   +upstreamnt  +downstreamnt
atggcaaagattttcaagcgtattacagatttagtgggccgcacaccgctcgtggagctg
gccaagtattcggctttgcggggtgccggcacccctgttgtggccaaggtggagtcgttc
aatcccggtggcagcgtgaaagaccgcatcgccctggccatgatcgaggccgccgaagcc
caggggttgctcaagcccggagccaccatcatcgagcccacgagcggcaacaccggcgtg
gggctggccctggtctcggccgtcaagggctacaagctcatcctgaccatgcccgagact
atgagcatggagcggcgcaacctggtgaaagcctatggagcccaggtgaaactcaccagc
ggagcggccggcatgggcggtgccatcaaggccgccgaggagctgcgcgactccattcca
ggctcgataatcctggggcagttcgtgaatcaggctaacccgcagcggcactacgacacc
acggggctggaaatctgggaagacaccgacgggcaggtagacatcttcgtggccggcgtg
ggcacgggcggaacggtgtcgggcattggccggagactcaaggagaagaaccccggggtg
aagattgtggctgtggagcccagcgcatcgcccgtgttgagcggcggcaccgccggcccg
cacaagattcagggcatcggtgcaggctttgttcccgctacttatgacgcttccgtggtg
gacgaggtggtgcgcgtggacaacgacgatgccattctggccggtcgccaactggcccaa
caggagggtctgctcgtgggcatctcgtcgggggcggccgcctttgccgccaccgagctg
gcccgccgccctgagaatgcgggcaagcgcatcgtggtgttgctgcccgacacgggcgaa
cgctacctctccaccgtgctctacgcctttgacgagtatccgctttaa

DBGET integrated database retrieval system