Prevotella dentalis: Prede_1008 Help Entry Prede_1008        CDS       T02403                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pdt  Prevotella dentalis Pathway pdt01100   Metabolic pathways pdt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pdt00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Prede_1008    00074 Mycolic acid biosynthesis     Prede_1008   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Prede_1008 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding MboIIR_C CRISPR_Cse2 Motif Other DBs NCBI-ProteinID:  AGB28346 UniProt:  F9D1Z9 LinkDB All DBs Position 1:1230062..1230304 Genome browser AA seq 80 aa AA seqDB search MEREEVLTQLNEIFAEVFKRPGMQLDYAQSADDIDEWDSLTNMTLISEVEHRWGFKFKLH DIIKMRNVGDMVDCIVKRAK NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggaaagagaagaagtattgactcaactcaacgagatttttgcagaagtattcaaacgt cccggcatgcagctggactatgcacagtcggccgatgacatagacgagtgggactcgctc accaatatgacgctcatcagcgaagtggagcaccggtggggcttcaagttcaagctgcac gacatcatcaagatgcgcaacgtgggcgacatggtagactgtatcgtgaagcgcgccaaa tag

DBGET integrated database retrieval system