Prevotella dentalis: Prede_1071
Help
Entry
Prede_1071 CDS
T02403
Name
(GenBank) DNA mismatch repair protein MutL
KO
K03572
DNA mismatch repair protein MutL
Organism
pdt
Prevotella dentalis
Pathway
pdt03430
Mismatch repair
Brite
KEGG Orthology (KO) [BR:
pdt00001
]
09120 Genetic Information Processing
09124 Replication and repair
03430 Mismatch repair
Prede_1071
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03400 DNA repair and recombination proteins [BR:
pdt03400
]
Prede_1071
DNA repair and recombination proteins [BR:
pdt03400
]
Prokaryotic type
SSBR (single strand breaks repair)
MMR (mismatch excision repair)
Molecular matchmaker
Prede_1071
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
DNA_mis_repair
MutL_C
HATPase_c_3
HATPase_c
CjCas9_PI_CTD
Motif
Other DBs
NCBI-ProteinID:
AGB28405
UniProt:
F9D264
LinkDB
All DBs
Position
1:complement(1343964..1345847)
Genome browser
AA seq
627 aa
AA seq
DB search
MSDIIQLLPDSVANQIAAGEVIQRPASVVKELVENAVDAGARRIDVLVVDAGRTSIQVVD
DGKGMSETDARLSFERHATSKIRQADDLFNLRTMGFRGEALASIAAVAQVELRTRMASDE
LGTHLAISGSRFGGQEPCACPVGSNFLIENLFFNVPARRKFLKSNSTELNNIIAAFERIV
LVYPDIAFTFRSNGSEMYALRAGNLRQRIVDLFGKRINQDLLPVKVETSVCSIGGFVGKP
ESARKKGARQFFFVNGRYMRHPYFHKAVMSAFERLVPQGDQVPYFLYFDVSPQDIDVNIH
PTKTEIKFENEQAIWQILSASVKDAVGMFNDVSAIEFDTEGKPDIPVFDPNNPAQSPRVE
FNPQYNPFDTPATGMVERRSRLGGSSSDGPSAGGWTPAPQSRMGAPAQWEQLYEGLAPAA
EAPGALFPADGAAPGSLIDEKSPAHYQYKGRYIMTAVKSGLMIVDQHRAHLRILYEQYRR
QLAARKMHAQKLLFPESLQLSAQEAVTLDRIRPELEGMGFELSPLGGGAFAVNAIPEGLE
GISVPVLVRDMLAAAAEKGTSATAGVNDALALSMARSAAIPYGQVLGNEEMENLINGLFG
CDNVNYTPDGKSVLCIFKQHDIEQLMG
NT seq
1884 nt
NT seq
+upstream
nt +downstream
nt
atgagcgatattatccaacttttacccgactccgtggccaaccagatagcggccggcgag
gtgattcagcggccggcctccgtcgtcaaggaactggtggagaatgccgtcgatgccggt
gctcgccgcatcgatgtgcttgtggtcgatgccggccgcacgtccattcaggtggtcgac
gacggcaagggcatgtccgagaccgacgcccgcctctcgttcgagcggcacgccacctcg
aagatacgccaggccgacgacctcttcaacctgcgcaccatgggctttcgcggcgaagcc
ctggcctcgattgccgccgtggcccaggtggaactccgcacgcgcatggcgtccgacgag
cttggcacccaccttgccatttccggctcgcgcttcggcgggcaggagccctgcgcctgt
ccggtgggttccaacttcctcatcgagaacttgttcttcaacgttccggcccgccgcaag
ttcctgaaatccaattccaccgagctcaacaacatcatcgccgccttcgagcgcatcgtg
ctcgtctatcccgacattgctttcacgttccgcagcaacggctccgaaatgtacgccctg
cgggccggcaacctgcggcagcgcattgtcgacctcttcggcaagcgcatcaatcaggac
ctgctgcccgtcaaggtggagacctcggtgtgcagcatcggcggtttcgtgggcaagccc
gagtcggcccgcaagaaaggcgcgcgccaattcttctttgtcaacggccgctacatgcgt
cacccgtacttccacaaggccgtcatgtcggcctttgagcggctggtgccgcagggcgac
caggtgccctacttcctctattttgacgtcagcccgcaggacatcgacgtgaacatacac
cccacgaagaccgagatcaagtttgaaaacgagcaagccatctggcagattctctcggcc
tcggtcaaggatgccgtgggcatgttcaacgatgtgtcggccatcgagttcgacaccgag
ggcaaacccgacatccccgtcttcgatcccaacaacccggcgcagtcgccccgggtcgag
ttcaacccgcagtacaatcctttcgacacccccgccacaggcatggtggagcggcgcagc
cggctgggcggcagcagttccgacggcccctcggccggcggctggacgcccgccccgcag
tcccgcatgggcgccccggcccaatgggagcagctctacgaggggctggcgccggctgcc
gaggctcccggcgcgcttttccctgctgacggggccgccccaggcagcctcatcgacgag
aagtcgcccgcccactaccagtacaagggccgttacatcatgacggccgtcaagtcgggc
ctcatgattgtagaccagcatcgggcccacctccgcatactctacgagcagtatcggcgg
cagctcgccgcgcgcaagatgcacgcccagaagctgctcttccccgagtcgctgcagctc
tcagcccaggaggccgtcacgctggaccgcatccggcccgagctggagggcatgggcttc
gagctttcgccgctgggcggaggcgcctttgccgtgaatgccatccccgaggggctggag
ggcatcagcgtgcccgtgctggtgcgcgacatgctggccgccgccgccgagaaaggcacg
tcggccaccgccggcgtgaacgacgcgctggccctgagcatggcccgttccgccgccatc
ccctacggccaggtgctgggcaacgaggagatggagaacctcatcaacggtctcttcggc
tgcgacaacgtgaactatacgcccgacggcaagagcgtgctctgcatcttcaagcagcac
gacatcgagcagctcatgggttga
DBGET
integrated database retrieval system