Prunus dulcis (almond): 117624402 Help Entry 117624402         CDS       T07328                                  Name (RefSeq) thioredoxin-like protein CXXS1   KO K03671   thioredoxin Organism pdul  Prunus dulcis (almond) Brite KEGG Orthology (KO) [BR:pdul00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:pdul03110]     117624402 Chaperones and folding catalysts [BR:pdul03110]  Protein folding catalysts   Protein disulfide isomerase    117624402 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin Motif Other DBs NCBI-GeneID:  117624402 NCBI-ProteinID:  XP_034211502 LinkDB All DBs Position 4:12821071..12823439 Genome browser AA seq 75 aa AA seqDB search MDVHDQQQLKKSRVVRVNSEELWDFFLTQAANQGCPGVARKMEIKAMPTFLMMKGGDSTD KLVGANPDAIKKMLK NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggatgtgcatgatcagcagcagctcaagaagtcaagggttgtcagagtgaactctgag gaattatgggatttctttctcactcaagctgccaatcaaggctgccctggagttgcccgc aagatggaaattaaagccatgcctactttcctcatgatgaaaggaggagattcaactgat aagcttgtgggtgctaatccagatgccatcaagaaaatgctcaaataa

DBGET integrated database retrieval system