Prunus dulcis (almond): 117628270 Help Entry 117628270         CDS       T07328                                  Name (RefSeq) protein MHF1 homolog   KO K11511   centromere protein S Organism pdul  Prunus dulcis (almond) Pathway pdul03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:pdul00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     117628270  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pdul03036]     117628270    03400 DNA repair and recombination proteins [BR:pdul03400]     117628270 Chromosome and associated proteins [BR:pdul03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      117628270 DNA repair and recombination proteins [BR:pdul03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      117628270 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-S CENP-T_C TFIID-31kDa Bromo_TP Histone UCH_UBL1 Antigen_Bd37 RBP_receptor Motif Other DBs NCBI-GeneID:  117628270 NCBI-ProteinID:  XP_034216578 LinkDB All DBs Position 5:complement(12525071..12526698) Genome browser AA seq 128 aa AA seqDB search MGREEEDSVSELLRDRFRVSTISIAEAEAKRNDMEISGPVMTCIADLAFKFTEQLAKDLE LFAQHAGRKTANMEDVILSAHRNEHLAALLRSFSNDLKAREPQSERKRKKSSKKEDQATT SVVHIPDS NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atggggagggaagaagaagactcggtgagcgagcttttgagagatcgattcagagtctcc accatctctatcgccgaagccgaagcgaagagaaacgacatggaaatttcgggacccgtg atgacttgcattgccgatttggccttcaaatttactgaacagttggcaaaggacctggag ttatttgcccaacacgctggtcgtaaaactgcaaacatggaagatgtcatactttctgca catagaaatgaacatctggctgccttattgaggtccttcagcaatgatctgaaagccaga gagccccaatctgagaggaagagaaagaaatcatcaaaaaaggaagaccaagcaactacc agcgtagtccatattccagattcttag

DBGET integrated database retrieval system