Prunus dulcis (almond): 117628482 Help Entry 117628482         CDS       T07328                                  Name (RefSeq) calmodulin-like   KO K02183   calmodulin Organism pdul  Prunus dulcis (almond) Pathway pdul04016   MAPK signaling pathway - plant pdul04070   Phosphatidylinositol signaling system pdul04075   Plant hormone signal transduction pdul04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:pdul00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     117628482    04070 Phosphatidylinositol signaling system     117628482    04075 Plant hormone signal transduction     117628482  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     117628482  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pdul01009]     117628482   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pdul04131]     117628482    03036 Chromosome and associated proteins [BR:pdul03036]     117628482   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pdul04147]     117628482 Protein phosphatases and associated proteins [BR:pdul01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      117628482 Membrane trafficking [BR:pdul04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     117628482 Chromosome and associated proteins [BR:pdul03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      117628482 Exosome [BR:pdul04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    117628482 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_9 EF-hand_5 MTIP_N AIF-1 EF-hand_8 UPF0154 EF-hand_11 EF_EFCAB10_C Motif Other DBs NCBI-GeneID:  117628482 NCBI-ProteinID:  XP_034216840 LinkDB All DBs Position 5:complement(7014254..7015692) Genome browser AA seq 79 aa AA seqDB search MSNELSDDQVEKLKQAFNNFDKDGNGTVTTDELSNVMTSIGQNPSEEELEEFIQQMGGDD GRVRFDQFLKFMAKFMNAQ NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtctaacgaattgagtgatgatcaagtcgagaagctcaagcaagccttcaacaatttt gacaaggatggcaatggtactgtcactaccgatgagctgagcaatgtaatgacctcaata gggcaaaacccatccgaagaagaattggaagaatttattcaacagatgggcggtgatgat gggagggttcgttttgatcaattcttgaaattcatggcaaaattcatgaacgctcagtga

DBGET integrated database retrieval system