Prunus dulcis (almond): 117632340 Help Entry 117632340         CDS       T07328                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism pdul  Prunus dulcis (almond) Brite KEGG Orthology (KO) [BR:pdul00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:pdul03041]     117632340   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pdul04052]     117632340 Spliceosome [BR:pdul03041]  Complex B   Other components    Complex B specific factors     117632340 Cytokines and neuropeptides [BR:pdul04052]  Neuropeptides   Unclassified    117632340 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Rad60-SLD Ubiquitin_4 OTU1_UBXL HCBP_related Crinkler Motif Other DBs NCBI-GeneID:  117632340 NCBI-ProteinID:  XP_034221679 LinkDB All DBs Position 6:complement(22495566..22497243) Genome browser AA seq 73 aa AA seqDB search MIEVVLNDRLGKKVKVKCNEDDTIGDLKKLVAAQTGTRSDKIRIQKWYNVYKDHITLKDY EIHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgattgaggtggtgctgaacgatcgtctcgggaagaaggtgaaggtgaagtgcaacgag gatgacaccataggcgacctcaagaagctcgtggctgctcagacgggtacccgatccgac aagattcggatccagaagtggtacaacgtctacaaggaccacatcaccctcaaggactat gaaatccatgacggcatgggcctcgagctctattacaactaa

DBGET integrated database retrieval system