Pseudomonas donghuensis: BV82_1623 Help Entry BV82_1623         CDS       T07361                                  Name (GenBank) TIGR02449 family protein   KO K09892   cell division protein ZapB Organism pdw  Pseudomonas donghuensis Brite KEGG Orthology (KO) [BR:pdw00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pdw03036]     BV82_1623 Chromosome and associated proteins [BR:pdw03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     BV82_1623 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ADIP Filament Asd-4 ZapB Motif Other DBs NCBI-ProteinID:  KDO00529 UniProt:  A0AAP0SKL5 LinkDB All DBs Position 5574729..5574938 Genome browser AA seq 69 aa AA seqDB search MQENDLQALMGRFELLIERVEQLKRQNALLLAQEKSWREERAHLIEKNEIARRKVESMIL RLKALEQDS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgcaagagaacgatctgcaagcgctgatgggccgattcgaactgctgattgagcgggtc gagcaactaaaacggcaaaacgcactcttattagctcaggaaaaatcctggcgcgaagag cgcgcccacctcatcgaaaaaaatgaaatcgcccggcgtaaggtcgaatcgatgattttg cgactcaaggccctggagcaagactcatga

DBGET integrated database retrieval system