Pseudomonas donghuensis: BV82_2593 Help Entry BV82_2593         CDS       T07361                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pdw  Pseudomonas donghuensis Pathway pdw01100   Metabolic pathways pdw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pdw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BV82_2593    00074 Mycolic acid biosynthesis     BV82_2593   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BV82_2593 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  KDN99383 UniProt:  A0AAP0SFD3 LinkDB All DBs Position complement(485822..486094) Genome browser AA seq 90 aa AA seqDB search MSDPQNTLNHDIKLLIIDALGLEDISAQDIGDEQTLFGEGLGLDSVDALELGLAIQKKYG IKIDADAKDTRNHFTSVASLAAFVTAKQAA NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgagcgatccacagaacacccttaaccacgacatcaagctgttgatcatcgacgccctg ggcctggaagacatcagcgcccaggacatcggcgacgagcagaccctgtttggcgaaggc ctgggcctggattcggtggacgccctcgaactcggcctggcgatccagaagaagtacggc atcaagatcgacgccgatgccaaggacacccgtaaccatttcaccagcgtggccagcctt gcggctttcgtcaccgctaaacaggcagcctga

DBGET integrated database retrieval system