Pseudonocardia dioxanivorans: Psed_3444 Help Entry Psed_3444         CDS       T01479                                  Name (GenBank) hypothetical protein   KO K13993   HSP20 family protein Organism pdx  Pseudonocardia dioxanivorans Brite KEGG Orthology (KO) [BR:pdx00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     Psed_3444  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:pdx03110]     Psed_3444 Chaperones and folding catalysts [BR:pdx03110]  Heat shock proteins   HSP20    Psed_3444 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HSP20 Motif Other DBs NCBI-ProteinID:  AEA25632 UniProt:  F4CZA1 LinkDB All DBs Position complement(3682822..3683043) Genome browser AA seq 73 aa AA seqDB search MTLMQLDSFCECDRIVEQNSPEGRAAFRLQRRGCDTFLVDLDIPGVDRIDVEVTVERCLL TVRAPPRRRSPAR NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgaccttgatgcaactggactcgttctgcgagtgtgatcgcattgtggagcagaattcc ccggagggccgcgcggcattccggttgcagcgtcgcggctgcgacacgttcctggtcgat ctcgatattcccggggtggatcgaatcgacgtcgaggtgacggtcgagcgctgtctgctc accgtcagggccccgccgcgccgccgatcgccagcacggtga

DBGET integrated database retrieval system