Phytobacter diazotrophicus: HHA33_06900 Help Entry HHA33_06900       CDS       T06586                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pdz  Phytobacter diazotrophicus Pathway pdz01100   Metabolic pathways pdz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pdz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HHA33_06900    00074 Mycolic acid biosynthesis     HHA33_06900   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HHA33_06900 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QJF19777 LinkDB All DBs Position complement(1444302..1444559) Genome browser AA seq 85 aa AA seqDB search MQALYLEIKNLIIDTLNLDELTAEDINTDAALFGDGLGLDSIDALELGLAVKNQYGIVLS AESEEMRQHFYSVATLASFIHSQRA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaagcgctttatctcgaaattaaaaatcttattatcgacacgttaaatcttgatgag ttgacggcggaagatatcaacaccgatgcagcattattcggggatgggttgggtctggat tctattgacgcgcttgagcttggtctggcggtgaaaaatcaatatggcatagtgctttca gccgagagcgaagaaatgcgacagcatttttattccgtggcaacactggcctctttcatt cattcacaacgcgcctga

DBGET integrated database retrieval system