Phytobacter diazotrophicus: HHA33_12195 Help Entry HHA33_12195       CDS       T06586                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pdz  Phytobacter diazotrophicus Pathway pdz01100   Metabolic pathways pdz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pdz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HHA33_12195 (acpP)    00074 Mycolic acid biosynthesis     HHA33_12195 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HHA33_12195 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  QJF17249 LinkDB All DBs Position 2543554..2543790 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgagcagctgggcgttaagcag gaagaagttaccaacaatgcttccttcgttgaagacctgggcgctgattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggtcaccaggcgtaa

DBGET integrated database retrieval system