KEGG   Primulina eburnea: 140807292
Entry
140807292         CDS       T11060                                 
Name
(RefSeq) abscisic acid receptor PYL4-like
  KO
K14496  abscisic acid receptor PYR/PYL family
Organism
pebu  Primulina eburnea
Pathway
pebu04016  MAPK signaling pathway - plant
pebu04075  Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:pebu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    140807292
   04075 Plant hormone signal transduction
    140807292
SSDB
Motif
Pfam: Polyketide_cyc2 Bet_v_1 Polyketide_cyc TolA
Other DBs
NCBI-GeneID: 140807292
NCBI-ProteinID: XP_073020185
LinkDB
Position
12:complement(4136687..4137535)
AA seq 213 aa
MPSSLQIQRINHINHTTSGSSCAAAKRTWVSPVSSEVPLPENASQHHTKAVGSNQSCSTV
VQKIHAPVDTVWSVVRRFDKPQAYKHFLKSCDVILGHGEVGTLREVRVVSGLPAVCSTER
LEILDDEKHVLSFSVVGGDHRLHNYRSVTTLHAAPPYQLGVGGGSGGTVVVESYVVDVPQ
GNTREETCAFVDTIVRCNLRSLAQISENLAKNQ
NT seq 642 nt   +upstreamnt  +downstreamnt
atgccttcctctcttcagattcaaagaatcaaccacataaatcacaccacttctggatca
tcctgcgccgccgcgaagcgcacatgggtttcgcctgtttccagcgaggttccgctgccg
gaaaacgcttcgcaacaccacacgaaagctgtgggttccaaccagagctgctccaccgtg
gtccagaagatccatgcgcccgtggacaccgtgtggtcagtcgtccgccgcttcgacaaa
ccgcaagcgtacaagcacttcctcaagagctgcgacgtcatcctcggccacggtgaagtg
ggcactctccgggaggttcgggttgtgtccggtctcccggcggtgtgtagcacggagagg
ctggaaatattggacgatgagaagcacgtgttgagtttcagcgtagtaggcggcgatcac
cgtttgcacaattatcgctccgttaccacactccatgcagcgccgccgtatcagctgggc
gtcggcggaggaagtggtgggacggtggtggtagaatcatacgttgtggatgttccacaa
gggaacaccagagaagaaacttgtgcgtttgttgatacaattgtgaggtgcaatctgcgg
tcgttggctcaaatctcagaaaatttggccaaaaatcagtaa

DBGET integrated database retrieval system