Primulina eburnea: 140814348 Help Entry 140814348         CDS       T11060                                  Name (RefSeq) uncharacterized protein   KO K10418   dynein light chain LC8-type Organism pebu  Primulina eburnea Pathway pebu04145   Phagocytosis pebu04517   IgSF CAM signaling pebu04814   Motor proteins Brite KEGG Orthology (KO) [BR:pebu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     140814348  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     140814348   09142 Cell motility    04814 Motor proteins     140814348  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pebu03037]     140814348    04812 Cytoskeleton proteins [BR:pebu04812]     140814348 Cilium and associated proteins [BR:pebu03037]  Motile cilia and associated proteins   Dynein arm    140814348 Cytoskeleton proteins [BR:pebu04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      140814348 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  140814348 NCBI-ProteinID:  XP_073029398 LinkDB All DBs Position 15:complement(35156692..35157437) Genome browser AA seq 109 aa AA seqDB search MLEGKAVIGETDMLQTMQQDALDLAAKALDFFDVTEATEIARSIKKGFDTMYGPGWQCIV GKDFGSFVTHCYGCFIHFCVGSLTILLFRGSTGLEFEGDREFPTLKSMA NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atgttggaaggaaaggcagtgattggtgagactgatatgcttcagaccatgcaacaagat gctctagatttggctgcaaaagcacttgatttcttcgacgtcacagaagccactgaaatt gcccgatctattaagaagggatttgatacgatgtatggaccaggttggcaatgtattgta ggaaaggactttggttcgtttgtcacacattgttacggttgtttcatacatttttgtgtt gggagccttactattttactcttcagaggatcgacgggactagaattcgagggagatcgt gaattcccgactttgaagagcatggcctaa

DBGET integrated database retrieval system