Primulina eburnea: 140825781 Help Entry 140825781         CDS       T11060                                  Name (RefSeq) sm-like protein LSM8   KO K12627   U6 snRNA-associated Sm-like protein LSm8 Organism pebu  Primulina eburnea Pathway pebu03018   RNA degradation pebu03040   Spliceosome Brite KEGG Orthology (KO) [BR:pebu00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     140825781   09123 Folding, sorting and degradation    03018 RNA degradation     140825781  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pebu03019]     140825781    03041 Spliceosome [BR:pebu03041]     140825781 Messenger RNA biogenesis [BR:pebu03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      140825781   mRNA degradation factors    5'-3' decay     Lsm complex      140825781 Spliceosome [BR:pebu03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     140825781 SSDB OrthologParalogGFIT Motif Pfam:  LSM M11L Motif Other DBs NCBI-GeneID:  140825781 NCBI-ProteinID:  XP_073043837 LinkDB All DBs Position 3:6243710..6246660 Genome browser AA seq 98 aa AA seqDB search MSLGLGLESLVDQLISVITNDGRNIVGILKGFDQATNMILDESHERVYSTKEGVQQIVLG LYIIRGDNISVVGELDEDLEARLDLTELRAHPLKPVVH NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgtctcttggcctcggacttgagtctcttgttgatcaattaatttcggtaatcacaaat gatgggagaaatatcgtgggaattttaaaaggttttgatcaagctaccaacatgattctt gatgagtctcatgaacgagtatactcgaccaaggaaggtgtgcagcaaattgtgctgggt ctctacattataaggggtgataacataagcgtcgttggagaattagacgaagatctggag gctcgattggacttgacggaactacgagctcatcctcttaagccggttgtccattaa

DBGET integrated database retrieval system