Primulina eburnea: 140827150 Help Entry 140827150         CDS       T11060                                  Name (RefSeq) polyubiquitin 9-like   KO K03873   elongin-B Organism pebu  Primulina eburnea Pathway pebu04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:pebu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     140827150  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pebu04121]     140827150    03400 DNA repair and recombination proteins [BR:pebu03400]     140827150 Ubiquitin system [BR:pebu04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      140827150    Cul5 complex      140827150 DNA repair and recombination proteins [BR:pebu03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      140827150 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD UBL_UBAC1 Ubiquitin_2 Chal_sti_synt_N Dsc3_N Motif Other DBs NCBI-GeneID:  140827150 NCBI-ProteinID:  XP_073045865 LinkDB All DBs Position 3:18083195..18086990 Genome browser AA seq 104 aa AA seqDB search MAMYIRVKREKTTYFLQCVPSETILQIKEKLQELTDQPANNQRLILMSNREVLDDSKSLA DQKVENDAVVALTLRKDDNEFEDVNIVRPNDFYQSRDSEASSNW NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atggcaatgtatatccgtgttaaacgtgagaagacaacttacttcctgcaatgcgttcca agtgagacgattctacaaatcaaggagaagttgcaagaactcactgatcagccggctaac aatcaaagactgatactcatgtcaaatcgtgaagtgttggatgattcaaaatccttggca gatcaaaaggttgaaaatgatgctgtcgtcgccctgactctgagaaaagatgataacgag ttcgaggatgtaaatatcgtgcggccaaatgatttctaccagtcccgtgactcggaagct agttctaattggtga

DBGET integrated database retrieval system