Primulina eburnea: 140827280 Help Entry 140827280         CDS       T11060                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism pebu  Primulina eburnea Pathway pebu04145   Phagosome pebu04148   Efferocytosis pebu04620   Toll-like receptor signaling pathway pebu05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:pebu00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     140827280    04148 Efferocytosis     140827280  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     140827280  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     140827280  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pebu04131]     140827280   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pebu04147]     140827280    04031 GTP-binding proteins [BR:pebu04031]     140827280 Membrane trafficking [BR:pebu04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     140827280  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     140827280   Macropinocytosis    Ras GTPases     140827280  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     140827280 Exosome [BR:pebu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    140827280   Exosomal proteins of other body fluids (saliva and urine)    140827280   Exosomal proteins of colorectal cancer cells    140827280   Exosomal proteins of bladder cancer cells    140827280 GTP-binding proteins [BR:pebu04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     140827280 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf Motif Other DBs NCBI-GeneID:  140827280 NCBI-ProteinID:  XP_073046030 LinkDB All DBs Position 1:9980138..9983550 Genome browser AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFILSFSLISKASFENISKKWVPELRHYAPGVPIILVGTKL DLREDKQFFVDHSGAVPIMTAQGEELKKLIGATAYIECSAKTQQNVKAVFDAAIKVVLQP PKQKKKKKKGHKTCNIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagtgcgtcgaggtttataaagtgtgtaactgtcggagatggtgccgtgggtaaaact tgcctgctcatttcgtacaccagcaacacctttcccactgattatgtcccaactgtgttt gacaattttagtgccaatgttgtggtggatggaagcacggttaatttaggattgtgggat actgcaggccaggaggattacaatagattaagaccattgagttaccgtggagctgatgtc tttattctttcattttcccttatcagcaaggcgagctttgagaatatctccaagaagtgg gtacctgaattgcggcattatgctcctggagttccaataattcttgttggaacaaagctt gatcttcgtgaggataagcagttctttgtagatcactcaggagcagttcccatcatgact gcacagggagaggagttgaagaagttgattggagcaactgcttatatagaatgtagtgct aaaacacagcagaatgtgaaggcggtgtttgatgcagcaataaaagtcgtcctacagcca ccaaagcaaaagaagaaaaagaagaagggtcataaaacttgcaatatattgtga

DBGET integrated database retrieval system