Primulina eburnea: 140832751 Help Entry 140832751         CDS       T11060                                  Name (RefSeq) uncharacterized protein   KO K10418   dynein light chain LC8-type Organism pebu  Primulina eburnea Pathway pebu04517   IgSF CAM signaling pebu04814   Motor proteins Brite KEGG Orthology (KO) [BR:pebu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     140832751  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     140832751  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pebu03037]     140832751    04812 Cytoskeleton proteins [BR:pebu04812]     140832751 Cilium and associated proteins [BR:pebu03037]  Motile cilia and associated proteins   Dynein arm    140832751 Cytoskeleton proteins [BR:pebu04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      140832751 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  140832751 NCBI-ProteinID:  XP_073053021 LinkDB All DBs Position 1:complement(56829578..56830644) Genome browser AA seq 98 aa AA seqDB search MLEGKGLIQDTDMPLKMQIQAMDFASQALDLYDVVDCKSIAAHIKKEFDNRHGNGWQCVV GSNFGCFFTHKKGSFIYFTLESLKFLIFKVSSSPPSSP NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgttagaagggaaaggtttgatacaggatacagatatgccattgaagatgcagatccaa gcaatggattttgcttcccaggctctggatctgtatgatgtcgttgattgcaaatcaatt gctgcccacatcaagaaggagtttgacaataggcatgggaatggatggcaatgtgtggtg ggatcaaactttgggtgttttttcacacacaagaaagggagtttcatatattttacactt gaatctctcaagtttctcatcttcaaagtttcttcctctcccccatcttctccttga

DBGET integrated database retrieval system