Primulina eburnea: 140841808 Help Entry 140841808         CDS       T11060                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism pebu  Primulina eburnea Pathway pebu04145   Phagosome pebu04148   Efferocytosis pebu04620   Toll-like receptor signaling pathway pebu05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:pebu00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     140841808    04148 Efferocytosis     140841808  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     140841808  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     140841808  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pebu04131]     140841808   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pebu04147]     140841808    04031 GTP-binding proteins [BR:pebu04031]     140841808 Membrane trafficking [BR:pebu04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     140841808  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     140841808   Macropinocytosis    Ras GTPases     140841808  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     140841808 Exosome [BR:pebu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    140841808   Exosomal proteins of other body fluids (saliva and urine)    140841808   Exosomal proteins of colorectal cancer cells    140841808   Exosomal proteins of bladder cancer cells    140841808 GTP-binding proteins [BR:pebu04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     140841808 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  140841808 NCBI-ProteinID:  XP_073065597 LinkDB All DBs Position 9:32764721..32769222 Genome browser AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFILAFSLISRASYENISRKWIPELRHYAPGVPIILVGTKL DLREDKQFFVDHPGAVPIATAQGEELRKSIGAAAYIECSAKTQQNVKGVFDAAIKVVLMP KRKPRKKRRGQKACSIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagtgcgtcgaggtttataaagtgcgtcactgtaggtgatggagcagtgggtaaaact tgcttactcatttcctacaccagcaacacctttcccacggattatgtccccactgtgttt gacaattttagtgccaatgtggtggtggatgggagcaccgtgaatcttggattatgggat acagcaggccaagaggattacaatagattaagaccattaagctaccgtggggctgatgtc tttattcttgcattttcactcattagcagggctagttatgagaatatctccaggaagtgg attcctgaattgaggcattatgctcctggagttccaataattcttgttggaacaaagctt gatcttcgagaggataagcagttctttgtagatcatccaggagcagtacccatcgcgact gctcagggagaggagctgagaaagtcaataggagctgctgcttacattgaatgcagcgca aagacacagcagaatgtgaagggcgtatttgatgcagccatcaaggttgttctgatgcct aagcgaaagccgagaaagaagagaaggggccaaaaggcctgcagcatcttgtga

DBGET integrated database retrieval system