Primulina eburnea: 140841808 Help Entry 140841808         CDS       T11060                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism pebu  Primulina eburnea Pathway pebu04145   Phagosome pebu04148   Efferocytosis pebu04517   IgSF CAM signaling pebu04518   Integrin signaling pebu04620   Toll-like receptor signaling pathway pebu05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:pebu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     140841808    04518 Integrin signaling     140841808  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     140841808    04148 Efferocytosis     140841808  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     140841808  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     140841808  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pebu04131]     140841808   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pebu04147]     140841808    04031 GTP-binding proteins [BR:pebu04031]     140841808 Membrane trafficking [BR:pebu04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     140841808  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     140841808   Macropinocytosis    Ras GTPases     140841808  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     140841808 Exosome [BR:pebu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    140841808   Exosomal proteins of other body fluids (saliva and urine)    140841808   Exosomal proteins of colorectal cancer cells    140841808   Exosomal proteins of bladder cancer cells    140841808 GTP-binding proteins [BR:pebu04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     140841808 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  140841808 NCBI-ProteinID:  XP_073065597 LinkDB All DBs Position 9:32764721..32769222 Genome browser AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFILAFSLISRASYENISRKWIPELRHYAPGVPIILVGTKL DLREDKQFFVDHPGAVPIATAQGEELRKSIGAAAYIECSAKTQQNVKGVFDAAIKVVLMP KRKPRKKRRGQKACSIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagtgcgtcgaggtttataaagtgcgtcactgtaggtgatggagcagtgggtaaaact tgcttactcatttcctacaccagcaacacctttcccacggattatgtccccactgtgttt gacaattttagtgccaatgtggtggtggatgggagcaccgtgaatcttggattatgggat acagcaggccaagaggattacaatagattaagaccattaagctaccgtggggctgatgtc tttattcttgcattttcactcattagcagggctagttatgagaatatctccaggaagtgg attcctgaattgaggcattatgctcctggagttccaataattcttgttggaacaaagctt gatcttcgagaggataagcagttctttgtagatcatccaggagcagtacccatcgcgact gctcagggagaggagctgagaaagtcaataggagctgctgcttacattgaatgcagcgca aagacacagcagaatgtgaagggcgtatttgatgcagccatcaaggttgttctgatgcct aagcgaaagccgagaaagaagagaaggggccaaaaggcctgcagcatcttgtga

DBGET integrated database retrieval system