Pectobacterium parmentieri SCC3193: W5S_0179 Help Entry W5S_0179          CDS       T02514                                  Name (GenBank) Cell division protein zapB   KO K09892   cell division protein ZapB Organism pec  Pectobacterium parmentieri SCC3193 Brite KEGG Orthology (KO) [BR:pec00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pec03036]     W5S_0179 Chromosome and associated proteins [BR:pec03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     W5S_0179 SSDB OrthologParalogGFIT Motif Pfam:  ZapB CEP135_TSGA10_CC CtIP_N DUF8221 Leu_zip Seryl_tRNA_N bHLH_IRO3 CC149 SPC25_N Cep290_N ERM_helical PspA_IM30 CCDC110 Herpes_UL6 DUF3450 XRCC4_CC ZNF318_helical AKAP9_coil_N CC2-LZ USHBP1_PDZ-bd LEKR1 UPF0242 Nuf2_DHR10-like Rab11-FIP3 YabA dCache_2 FlaC_arch ZapB_rel DUF2968 CC_Bre1 APG6_N Motif Other DBs NCBI-ProteinID:  AFI88318 UniProt:  A0A0H3HYR6 LinkDB All DBs Position 202308..202547 Genome browser AA seq 79 aa AA seqDB search MSFEVFEKLEAKVQQAIDTITLLQMEIEELKEQNNTLSQDVQAAAGSREALVRENEQLKE EQVVWQERLRALLGKMEEV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtcatttgaagtgtttgaaaagctggaagcgaaagttcagcaggcgattgataccatc acgctgttgcaaatggaaattgaagagctgaaagaacaaaacaacacactgtcgcaggat gttcaggcggcagcgggttcacgtgaagcgctggtgcgcgagaacgaacagttgaaagaa gaacaagtagtatggcaagagcgcctgcgcgcgctgttaggcaaaatggaagaagtctaa

DBGET integrated database retrieval system