Pectobacterium parmentieri SCC3193: W5S_2787 Help Entry W5S_2787          CDS       T02514                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism pec  Pectobacterium parmentieri SCC3193 Pathway pec00998   Biosynthesis of various antibiotics pec01100   Metabolic pathways pec01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pec00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     W5S_2787    00074 Mycolic acid biosynthesis     W5S_2787   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     W5S_2787 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 EutQ Motif Other DBs NCBI-ProteinID:  AFI90872 UniProt:  A0A0H3IAC8 LinkDB All DBs Position complement(3018095..3018331) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIVEQLGVKQEEVVNNASFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDFIQANQQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaatcatcgttgaacagcttggtgttaagcag gaagaagtcgtaaacaatgcttctttcgttgatgacctcggcgctgattctcttgacact gttgagctggtaatggctctggaagaagaatttgatactgagattccagacgaagaagct gaaaaaatcacgactgttcaggcagccattgatttcattcaggctaaccagcagtaa

DBGET integrated database retrieval system