Pectobacterium parmentieri SCC3193: W5S_3258 Help Entry W5S_3258          CDS       T02514                                  Name (GenBank) DNA-binding protein HU-beta   KO K03530   DNA-binding protein HU-beta Organism pec  Pectobacterium parmentieri SCC3193 Brite KEGG Orthology (KO) [BR:pec00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pec03032]     W5S_3258    03036 Chromosome and associated proteins [BR:pec03036]     W5S_3258    03400 DNA repair and recombination proteins [BR:pec03400]     W5S_3258 DNA replication proteins [BR:pec03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     W5S_3258 Chromosome and associated proteins [BR:pec03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     W5S_3258 DNA repair and recombination proteins [BR:pec03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       W5S_3258 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  AFI91332 UniProt:  A0A0H3I733 LinkDB All DBs Position complement(3506921..3507193) Genome browser AA seq 90 aa AA seqDB search MNKSQLIDKIAADADISKAAAGRVLDAIIGSVTESLKEGDDVALVGFGTFSVRERAARTG RNPQTGKEISIPAAKVPGFRAGKTLKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgaacaagtcacaattgatcgacaaaattgccgcagatgctgatatttccaaagcggca gcagggcgtgtgttagatgcaattattggttccgttaccgaatccctgaaagaaggggat gatgttgccttagttggttttggtactttctcagtgcgtgaacgtgctgcccgtaccggt cgtaacccgcaaacgggtaaggaaatcagtatccctgcggcaaaagtaccaggattccgt gctggtaaaacgctgaaagacgctgttaactga

DBGET integrated database retrieval system