Pectobacterium parmentieri SCC3193: W5S_4755 Help Entry W5S_4755          CDS       T02514                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism pec  Pectobacterium parmentieri SCC3193 Pathway pec00998   Biosynthesis of various antibiotics pec01100   Metabolic pathways pec01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pec00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     W5S_4755    00074 Mycolic acid biosynthesis     W5S_4755   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     W5S_4755 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AFI92795 UniProt:  A0A0H3IBL2 LinkDB All DBs Position 5114249..5114515 Genome browser AA seq 88 aa AA seqDB search MESLFIEIKEMIIDSLNLEDISVDEIETDAPLFGEGLGLDSIDALELGLAVKNRYGVVLS AESEEVRQHFFSVATLAAFINTQRAVSA NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atggaaagtctatttattgaaatcaaagagatgattattgattctcttaatcttgaagat attagcgttgatgaaatagaaacggacgccccgctttttggcgagggtcttggtctggat tctattgatgcacttgaactggggctagcggttaaaaaccgttatggcgtcgtactttct gctgaaagtgaagaagtgcgccaacacttcttttccgttgctacccttgccgcttttatc aacactcagcgcgccgtaagtgcctga

DBGET integrated database retrieval system