Pectobacterium parmentieri SCC3193: W5S_4756 Help Entry W5S_4756          CDS       T02514                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism pec  Pectobacterium parmentieri SCC3193 Pathway pec00998   Biosynthesis of various antibiotics pec01100   Metabolic pathways pec01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pec00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     W5S_4756    00074 Mycolic acid biosynthesis     W5S_4756   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     W5S_4756 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF3913 PP-binding_2 Motif Other DBs NCBI-ProteinID:  AFI92796 UniProt:  A0A0H3IFC9 LinkDB All DBs Position 5114539..5114787 Genome browser AA seq 82 aa AA seqDB search MDKNEIYQEITGLLVKLFELDADEIKPESRLYEDLELDSIDAVDMVVHLQKRIGRKISPE IFKSVRTVQDVVDAVENLLREG NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggataaaaacgaaatttatcaggaaattaccggcttactggtcaagctgtttgaactg gatgctgatgagataaaacctgaatcccgcctctatgaagatcttgagttagatagcatt gacgccgtggatatggtggttcacctgcaaaaacgcatcgggcgcaaaatatcgccggaa atttttaaatctgtgcgtaccgtacaggatgtggttgatgcggtagaaaacctgctccgt gaaggttga

DBGET integrated database retrieval system