Candidatus Phaeomarinibacter ectocarpi: BN1012_Phect2660 Help Entry BN1012_Phect2660  CDS       T09856                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism pect  Candidatus Phaeomarinibacter ectocarpi Pathway pect01100   Metabolic pathways pect01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pect00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BN1012_Phect2660    00074 Mycolic acid biosynthesis     BN1012_Phect2660   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BN1012_Phect2660 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N DUF1493 Motif Other DBs NCBI-ProteinID:  CDO60873 UniProt:  X5MAI3 LinkDB All DBs Position 1109370..1109609 Genome browser AA seq 79 aa AA seqDB search MSDIAENVKKIVVEHLGVEADKVTENASFIDDLGADSLDTVELVMAFEEEFEVEIPDDAA ETILTVGDAIKFIKENASS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagtgacatcgcagagaacgtcaaaaagatcgttgttgagcaccttggcgttgaagcc gacaaggtcaccgaaaatgccagcttcattgacgacctgggcgcagacagcctggacacc gttgagctggttatggctttcgaagaagaattcgaagtcgaaatccctgatgatgctgct gaaaccatcctgacggttggcgatgcaatcaagttcatcaaggaaaacgccagcagctaa

DBGET integrated database retrieval system