Phycodurus eques (leafy seadragon): 133396319 Help Entry 133396319         CDS       T09682                                  Name (RefSeq) elongin-C isoform X1   KO K03872   elongin-C Organism pee  Phycodurus eques (leafy seadragon) Pathway pee04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:pee00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     133396319  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pee04121]     133396319    03400 DNA repair and recombination proteins [BR:pee03400]     133396319 Ubiquitin system [BR:pee04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      133396319    Cul5 complex      133396319 DNA repair and recombination proteins [BR:pee03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      133396319 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  133396319 NCBI-ProteinID:  XP_061522028 LinkDB All DBs Position 21:complement(12119649..12122148) Genome browser AA seq 112 aa AA seqDB search MDGEERTYGGCEGPEAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEV NFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atggatggtgaagaaaggacctatgggggctgtgaaggaccagaagccatgtatgtgaag ttgatttcttcagatggccatgagttcattgtgaaaagagaacacgcactgacatcgggt actatcaaggctatgctgagtggtccaggtcagtttgccgagaatgaaaccaacgaagtc aacttcagggagattccctctcatgtcctctccaaggtctgcatgtacttcacctacaag gtccgctacaccaacagctccacggaaatccctgaattccccatcgcccccgagattgca ctggaactgctcatggcggctaacttcctagattgctaa

DBGET integrated database retrieval system