Phycodurus eques (leafy seadragon): 133396745 Help Entry 133396745         CDS       T09682                                  Name (RefSeq) cystatin-B-like   KO K13907   cystatin-A/B Organism pee  Phycodurus eques (leafy seadragon) Brite KEGG Orthology (KO) [BR:pee00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:pee01002]     133396745   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pee04147]     133396745 Peptidases and inhibitors [BR:pee01002]  Peptidase inhibitors   Family I25: cystatin family    133396745 Exosome [BR:pee04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    133396745 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cystatin Dynein_light Motif Other DBs NCBI-GeneID:  133396745 NCBI-ProteinID:  XP_061522880 LinkDB All DBs Position 21:complement(15759226..15760311) Genome browser AA seq 98 aa AA seqDB search MMCGGLSDAQNAHAEIQKISDTVKPQAEQKTGNTYDVFVAKIYSSQVVAGTNYFIKVHVG GDDYVHIRVFQSLPHVGAGAELTAIQVSKRLDDAIEYF NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgatgtgcggagggctttcagacgctcaaaatgcccatgcagagattcaaaaaataagc gacaccgtgaagcctcaagctgagcagaaaactggcaatacttacgacgtctttgtcgcg aagatttacagctctcaagttgtggccgggacgaactacttcatcaaggtgcacgtggga ggagacgactacgtgcacattcgcgtcttccaaagtctgccgcacgtcggggcgggagcg gagctgaccgccatccaggtgtccaagagactcgacgacgccattgagtacttctga

DBGET integrated database retrieval system