Phycodurus eques (leafy seadragon): 133396770 Help Entry 133396770         CDS       T09682                                  Name (RefSeq) cystatin-B-like   KO K13907   cystatin-A/B Organism pee  Phycodurus eques (leafy seadragon) Brite KEGG Orthology (KO) [BR:pee00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:pee01002]     133396770   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pee04147]     133396770 Peptidases and inhibitors [BR:pee01002]  Peptidase inhibitors   Family I25: cystatin family    133396770 Exosome [BR:pee04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    133396770 BRITE hierarchy Motif Pfam:  Cystatin Dynein_light Motif Other DBs NCBI-GeneID:  133396770 NCBI-ProteinID:  XP_061522932 LinkDB All DBs Position 21:15765797..15766882 Genome browser AA seq 98 aa AA seqDB search MMCGGLSDAQNAHAEIQKISDTVKPQAEQKTGNTYDVFVAKIYSSQVVAGTNYFIKVHVG GDDYVHIRVFQSLPHVGAGAELTAIQVSKRLDDAIEYF NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgatgtgcggagggctttcagacgctcaaaatgcccatgcagagattcaaaaaataagc gacaccgtgaagcctcaagctgagcagaaaactggcaatacttacgacgtctttgtcgcg aagatttacagctctcaagttgtggccgggacgaactacttcatcaaggtgcacgtggga ggagacgactacgtgcacattcgcgtcttccaaagtctgccgcacgtcggggcgggagcg gagctgaccgccatccaggtgtccaagagactcgacgacgccattgagtacttctga

DBGET integrated database retrieval system