Phycodurus eques (leafy seadragon): 133397194 Help Entry 133397194         CDS       T09682                                  Symbol igf1 Name (RefSeq) insulin-like growth factor I   KO K05459   insulin-like growth factor 1 Organism pee  Phycodurus eques (leafy seadragon) Pathway pee04010   MAPK signaling pathway pee04068   FoxO signaling pathway pee04081   Hormone signaling pee04114   Oocyte meiosis pee04115   p53 signaling pathway pee04150   mTOR signaling pathway pee04510   Focal adhesion pee04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:pee00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     133397194 (igf1)    04068 FoxO signaling pathway     133397194 (igf1)    04150 mTOR signaling pathway     133397194 (igf1)   09133 Signaling molecules and interaction    04081 Hormone signaling     133397194 (igf1)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     133397194 (igf1)    04115 p53 signaling pathway     133397194 (igf1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     133397194 (igf1)  09150 Organismal Systems   09152 Endocrine system    04914 Progesterone-mediated oocyte maturation     133397194 (igf1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pee04052]     133397194 (igf1) Cytokines and neuropeptides [BR:pee04052]  Cytokines   Growth factors (RTK binding)    133397194 (igf1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  133397194 NCBI-ProteinID:  XP_061523784 LinkDB All DBs Position 22:1960347..1977250 Genome browser AA seq 189 aa AA seqDB search MPCALSSLRWHLWDVLKSAMCWMSRSHTLSLLLCVLSLTPAASGARPETLCGAELVDTLQ FVCGERGFYFSKPTGYGPNARRSRGIVDECCFQSCELRRLEMYCAPAKTSKAARSVRAQR HTDAPRAAKVGGGGAGHKADKGLDRRAAVQTDKTKIKKRPLPGHSHSAFKDLHPKNSSRS NTAGRNYRM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgccctgcgctctttcctccctccggtggcatttatgggacgtcctcaagagtgcgatg tgctggatgtcccgtagccacaccctctcgctactgctgtgcgtcctcagcctgactccg gcggcttcaggagcgcggccagagacgctgtgcggggcggagctggtcgacacgctgcag tttgtgtgcggagagaggggcttttatttcagtaagccaacgggctacggccccaacgcc cgccggtcacggggcatcgtggacgagtgctgcttccagagctgcgagctgcgccggctg gagatgtactgcgcgcccgccaagaccagcaaggccgcacgctcggtgcgcgcccagcgg cacacggacgctccgcgggccgccaaggtcggcgggggcggcgcgggccacaaggccgac aagggcttggatcgacgggcggccgtgcagacggacaagacaaaaattaagaagagacct ttacccggacacagtcattcagcctttaaggatttgcatcccaaaaactcaagtcgaagc aacaccgcgggccgaaactatcgaatgtag

DBGET integrated database retrieval system