Phycodurus eques (leafy seadragon): 133401238 Help Entry 133401238         CDS       T09682                                  Symbol s100a10b Name (RefSeq) protein S100-A10b   KO K17274   protein S100-A10 Organism pee  Phycodurus eques (leafy seadragon) Pathway pee04382   Cornified envelope formation pee05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pee00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     133401238 (s100a10b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     133401238 (s100a10b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pee04147]     133401238 (s100a10b) Exosome [BR:pee04147]  Exosomal proteins   Exosomal proteins of microglial cells    133401238 (s100a10b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_8 SPARC_Ca_bdg DEK_C Motif Other DBs NCBI-GeneID:  133401238 NCBI-ProteinID:  XP_061529937 LinkDB All DBs Position 4:complement(12163804..12166804) Genome browser AA seq 98 aa AA seqDB search MTDLEKCMENLIVIFHRYAKDDGDGKTLSKKELKKLLETELPTFLTTQKNPKTVDCILQD LDHNKDDKLDFEEFLPLVAGISMACEKCYMLRQKKGKQ NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgactgacttggagaaatgcatggagaacctcattgtcatattccatcgctacgccaaa gacgacggcgatgggaaaacgctgagcaaaaaagaactgaaaaaactgttggagactgag ttacccacattcctcacgactcaaaagaaccccaaaacggtggactgcatcttgcaggac ctggaccacaacaaagacgacaagttggactttgaagagtttctccccctggtcgcgggc atctccatggcctgtgagaagtgttacatgctgcgtcagaagaagggaaaacaatag

DBGET integrated database retrieval system