Phycodurus eques (leafy seadragon): 133401428 Help Entry 133401428         CDS       T09682                                  Symbol cdc42l Name (RefSeq) cell division cycle 42, like   KO K04393   cell division control protein 42 Organism pee  Phycodurus eques (leafy seadragon) Pathway pee04010   MAPK signaling pathway pee04144   Endocytosis pee04370   VEGF signaling pathway pee04510   Focal adhesion pee04517   IgSF CAM signaling pee04518   Integrin signaling pee04520   Adherens junction pee04530   Tight junction pee04810   Regulation of actin cytoskeleton pee04912   GnRH signaling pathway pee05100   Bacterial invasion of epithelial cells pee05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pee00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     133401428 (cdc42l)    04370 VEGF signaling pathway     133401428 (cdc42l)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     133401428 (cdc42l)    04518 Integrin signaling     133401428 (cdc42l)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     133401428 (cdc42l)   09144 Cellular community - eukaryotes    04510 Focal adhesion     133401428 (cdc42l)    04520 Adherens junction     133401428 (cdc42l)    04530 Tight junction     133401428 (cdc42l)   09142 Cell motility    04810 Regulation of actin cytoskeleton     133401428 (cdc42l)  09150 Organismal Systems   09152 Endocrine system    04912 GnRH signaling pathway     133401428 (cdc42l)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     133401428 (cdc42l)    05100 Bacterial invasion of epithelial cells     133401428 (cdc42l)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pee04131]     133401428 (cdc42l)    03036 Chromosome and associated proteins [BR:pee03036]     133401428 (cdc42l)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pee04147]     133401428 (cdc42l)    04031 GTP-binding proteins [BR:pee04031]     133401428 (cdc42l) Membrane trafficking [BR:pee04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     133401428 (cdc42l)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     133401428 (cdc42l)   Macropinocytosis    Ras GTPases     133401428 (cdc42l) Chromosome and associated proteins [BR:pee03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     133401428 (cdc42l) Exosome [BR:pee04147]  Exosomal proteins   Exosomal proteins of microglial cells    133401428 (cdc42l)   Exosomal proteins of breast milk    133401428 (cdc42l) GTP-binding proteins [BR:pee04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     133401428 (cdc42l) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  133401428 NCBI-ProteinID:  XP_061530403 LinkDB All DBs Position 4:18918704..18924748 Genome browser AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEISHHCPRTPFLLVGTQVDLR EDSNTIEKLAKNKQRPLYPDSAEKLARELRAVKYVECSALTQRGLKNVFDEAILAALEPP ETKTKRKCVLL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagactataaaatgtgtagttgtcggggatggtgcggtaggaaagacttgcttactc atctcctacacaaccaacaagttcccctcagaatatgtacccacggtttttgacaactat gcagtgacagtgatgatcgggggcgagccctacacactaggcctttttgacactgcaggt caggaggattatgacaggctacgtcctctcagctacccacagacagacgtgttccttgtg tgcttctctgtcgtctccccgtcgtcatttgaaaatgtcaaggagaagtgggttcctgag atttcccaccactgcccccgcacacccttcctgctggtgggcactcaagtggacctgcga gaggacagcaacaccattgagaagctagccaagaataaacagcgccccctgtaccccgac agtgccgagaaacttgcccgggagctcagggccgtcaaatacgttgagtgctctgctctc acacagcggggcctcaagaacgtgttcgacgaggccatcctggctgccttggagcccccc gagaccaaaaccaagaggaagtgcgtcctgctatag

DBGET integrated database retrieval system