Phycodurus eques (leafy seadragon): 133403059 Help Entry 133403059         CDS       T09682                                  Symbol kras Name (RefSeq) GTPase KRas isoform X1   KO K07827   GTPase KRas Organism pee  Phycodurus eques (leafy seadragon) Pathway pee04010   MAPK signaling pathway pee04012   ErbB signaling pathway pee04068   FoxO signaling pathway pee04137   Mitophagy - animal pee04140   Autophagy - animal pee04150   mTOR signaling pathway pee04210   Apoptosis pee04218   Cellular senescence pee04370   VEGF signaling pathway pee04371   Apelin signaling pathway pee04540   Gap junction pee04625   C-type lectin receptor signaling pathway pee04810   Regulation of actin cytoskeleton pee04910   Insulin signaling pathway pee04912   GnRH signaling pathway pee04914   Progesterone-mediated oocyte maturation pee04916   Melanogenesis Brite KEGG Orthology (KO) [BR:pee00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     133403059 (kras)    04012 ErbB signaling pathway     133403059 (kras)    04370 VEGF signaling pathway     133403059 (kras)    04371 Apelin signaling pathway     133403059 (kras)    04068 FoxO signaling pathway     133403059 (kras)    04150 mTOR signaling pathway     133403059 (kras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     133403059 (kras)    04137 Mitophagy - animal     133403059 (kras)   09143 Cell growth and death    04210 Apoptosis     133403059 (kras)    04218 Cellular senescence     133403059 (kras)   09144 Cellular community - eukaryotes    04540 Gap junction     133403059 (kras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     133403059 (kras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     133403059 (kras)   09152 Endocrine system    04910 Insulin signaling pathway     133403059 (kras)    04912 GnRH signaling pathway     133403059 (kras)    04914 Progesterone-mediated oocyte maturation     133403059 (kras)    04916 Melanogenesis     133403059 (kras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pee04131]     133403059 (kras)   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:pee04031]     133403059 (kras) Membrane trafficking [BR:pee04131]  Endocytosis   Macropinocytosis    Ras GTPases     133403059 (kras) GTP-binding proteins [BR:pee04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     133403059 (kras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 FeoB_N Septin DUF6974 nSTAND3 Motif Other DBs NCBI-GeneID:  133403059 NCBI-ProteinID:  XP_061533536 LinkDB All DBs Position 5:12452440..12465499 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRVNKLSKEEKTPRC VKLKKCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacagaatataagctggttgtggtgggagctggtggcgttggcaagagcgcacttacc attcagctcatccagaatcactttgtggatgaatatgaccccaccattgaggactcgtac agaaagcaagtggtgattgacggagagacgtgtctgctggacatcctggacactgcaggt caggaggagtacagcgccatgagagatcagtatatgaggacaggggagggcttcctctgt gtctttgccatcaacaacaccaagtcctttgaggacattcaccactacagagaacagata aagcgagttaaggactctgaggatgtccccatggtgctggtgggcaacaagtgtgacctc ccgtcccggactgtggacaccaagcaggctcaggacttagcacggagctacggcattccc ttcattgagacctcagccaaaaccagacagagagtggaagatgccttttacactctggta cgggagatcaggcagtaccgcgtcaataagctcagcaaggaagaaaagaccccacgctgt gtcaagcttaaaaagtgtgttgtgatgtga

DBGET integrated database retrieval system