Phycodurus eques (leafy seadragon): 133403510 Help Entry 133403510         CDS       T09682                                  Symbol pold4 Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism pee  Phycodurus eques (leafy seadragon) Pathway pee03030   DNA replication pee03410   Base excision repair pee03420   Nucleotide excision repair pee03430   Mismatch repair pee03440   Homologous recombination Brite KEGG Orthology (KO) [BR:pee00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     133403510 (pold4)    03410 Base excision repair     133403510 (pold4)    03420 Nucleotide excision repair     133403510 (pold4)    03430 Mismatch repair     133403510 (pold4)    03440 Homologous recombination     133403510 (pold4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pee03032]     133403510 (pold4)    03400 DNA repair and recombination proteins [BR:pee03400]     133403510 (pold4) DNA replication proteins [BR:pee03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     133403510 (pold4) DNA repair and recombination proteins [BR:pee03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       133403510 (pold4)    MMR (mismatch excision repair)     DNA polymerase delta complex      133403510 (pold4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 Stm1_N Motif Other DBs NCBI-GeneID:  133403510 NCBI-ProteinID:  XP_061534370 LinkDB All DBs Position 6:1019370..1047339 Genome browser AA seq 106 aa AA seqDB search MATKNGLITSSFKVVKKATNVAKRDERPPPPPQNTETPSPRHEDQQKLRQFDLDWRYGPS TGISRLQRWDRAKIHGLNPPEDIRDLLLLKQTDQEDKLSLWSEYPL NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atggctacgaagaatggacttataacttcttcattcaaggtggtgaagaaagcaacaaat gtagcaaagcgggatgagaggccacctcctccaccacaaaatacagaaactccatcaccc cgacatgaagaccaacagaaactgagacagtttgacctggactggagatatgggcccagt acaggtatcagcaggcttcaaagatgggacagggcaaagattcatggtttgaatccacct gaggacatccgagacttgctgctgctaaaacaaactgatcaagaggacaagttgagttta tggagcgaatatcctttgtga

DBGET integrated database retrieval system