Phycodurus eques (leafy seadragon): 133403680 Help Entry 133403680         CDS       T09682                                  Symbol ubl5 Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism pee  Phycodurus eques (leafy seadragon) Brite KEGG Orthology (KO) [BR:pee00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:pee03041]     133403680 (ubl5)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pee04052]     133403680 (ubl5) Spliceosome [BR:pee03041]  Complex B   Other components    Complex B specific factors     133403680 (ubl5) Cytokines and neuropeptides [BR:pee04052]  Neuropeptides   Unclassified    133403680 (ubl5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler Motif Other DBs NCBI-GeneID:  133403680 NCBI-ProteinID:  XP_061534792 LinkDB All DBs Position 6:18062287..18067259 Genome browser AA seq 73 aa AA seqDB search MIEVVCNDRLGKKVRVKCNSEDTIGDLKKLIAAQTGTRYDKIILKKWYTIFKDHVSLGDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggtggtctgcaacgatcgtctgggcaagaaagtccgggtaaagtgcaattct gaggacaccatcggagacctgaagaagctcattgcagcccagacggggacgcggtatgac aaaatcatcttgaagaaatggtacaccatattcaaggaccacgtgtcactgggagactat gagatccacgatggcatgaacctggagttgtactatcagtga

DBGET integrated database retrieval system