Phycodurus eques (leafy seadragon): 133403796 Help Entry 133403796         CDS       T09682                                  Symbol cxcl8a Name (RefSeq) interleukin-8 isoform X1   KO K10030   interleukin 8 Organism pee  Phycodurus eques (leafy seadragon) Pathway pee04060   Cytokine-cytokine receptor interaction pee04218   Cellular senescence pee04620   Toll-like receptor signaling pathway pee04621   NOD-like receptor signaling pathway pee04622   RIG-I-like receptor signaling pathway pee05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pee00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     133403796 (cxcl8a)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     133403796 (cxcl8a)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     133403796 (cxcl8a)    04621 NOD-like receptor signaling pathway     133403796 (cxcl8a)    04622 RIG-I-like receptor signaling pathway     133403796 (cxcl8a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     133403796 (cxcl8a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pee04052]     133403796 (cxcl8a)    00536 Glycosaminoglycan binding proteins [BR:pee00536]     133403796 (cxcl8a) Cytokines and neuropeptides [BR:pee04052]  Cytokines   Chemokines    133403796 (cxcl8a) Glycosaminoglycan binding proteins [BR:pee00536]  Heparan sulfate / Heparin   Chemokines    133403796 (cxcl8a) BRITE hierarchy Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  133403796 NCBI-ProteinID:  XP_061535046 LinkDB All DBs Position 6:complement(30414418..30415757) Genome browser AA seq 99 aa AA seqDB search MMSKVILSALVVLLASVAISEGMALRSLGVELHCRCIQTESRPIGRHIEKVELIPANSHC VETEIIATLKKTGQEVCLDPRAPWVTRVIQRIIENSKRR NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgatgagcaaagtgatcctcagtgctttggtggtcctgctggcttctgtggccatcagt gaaggaatggctctgagaagcttgggagtggagctgcactgccgctgcatccagacggag agcagacccatcggccgccacatcgagaaggtggagctgattcccgccaactcccactgc gtggagaccgagatcattgctacacttaaaaagaccggccaggaggtgtgcctcgacccc cgtgctccctgggtgacgagagtcattcagaggatcatcgagaacagcaaaagacgctga

DBGET integrated database retrieval system