Phycodurus eques (leafy seadragon): 133405122 Help Entry 133405122         CDS       T09682                                  Symbol hmgb1b Name (RefSeq) high mobility group protein B1b   KO K10802   high mobility group protein B1 Organism pee  Phycodurus eques (leafy seadragon) Pathway pee03410   Base excision repair pee04140   Autophagy - animal pee04217   Necroptosis Brite KEGG Orthology (KO) [BR:pee00001]  09120 Genetic Information Processing   09124 Replication and repair    03410 Base excision repair     133405122 (hmgb1b)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     133405122 (hmgb1b)   09143 Cell growth and death    04217 Necroptosis     133405122 (hmgb1b)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pee03036]     133405122 (hmgb1b)    03400 DNA repair and recombination proteins [BR:pee03400]     133405122 (hmgb1b)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pee04147]     133405122 (hmgb1b) Chromosome and associated proteins [BR:pee03036]  Eukaryotic type   Nucleosome assembly factors    HMG (high mobility group) proteins     133405122 (hmgb1b) DNA repair and recombination proteins [BR:pee03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Other BER factors      133405122 (hmgb1b)    MMR (mismatch excision repair)     Other MMR factors      133405122 (hmgb1b) Exosome [BR:pee04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    133405122 (hmgb1b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HMG_box_2 HMG_box HMG_WDHD1 DapB_C Beta-prop_IFT122_1st DUF6150 Dicty_REP PLC-beta_C Motif Other DBs NCBI-GeneID:  133405122 NCBI-ProteinID:  XP_061537782 LinkDB All DBs Position 7:28865137..28876175 Genome browser AA seq 201 aa AA seqDB search MGKDPKKPRGKMSSYAYFVQTCRGEHKKKHPDASVNFAEFSKKCSERWKTMSQKEKGKFE DMAKQDKVRYDAEMKNYIPPKGQKMKRIKDPNAPKRPPSAFFLFCADFRPKVKGEHPGLS IGDMAKKLGEMWNSSSMEDKQPYEKKAAKLKEKYDKDIVAYRTKGKVDSSSAAAAAAADD DEDEDEEEEGDDDEDDDEDDE NT seq 606 nt NT seq  +upstreamnt  +downstreamnt atggggaaggatccaaagaagccccggggcaaaatgtcctcctacgcctactttgtgcaa acatgccgaggggagcacaagaagaagcatcccgacgccagcgtcaacttcgcagagttc tccaagaaatgctccgagcgatggaagacaatgtcccaaaaggagaagggcaaattcgaa gacatggccaagcaggacaaggtgcgctacgatgcagagatgaagaactacatccctccc aagggacagaagatgaagcggatcaaggacccaaacgccccgaagagaccaccgtctgcg ttcttcctgttctgcgccgacttccgccccaaggtgaaaggcgagcacccgggcctgtcc atcggcgacatggccaagaagctcggcgagatgtggaacagctcgtccatggaggacaag cagccctacgagaagaaggccgctaaactgaaggagaagtacgacaaggatatcgtggcc tatcgcacaaagggcaaagtggattccagctcggcggcggcggccgcagcagcggacgat gatgaggatgaagatgaggaagaggagggcgacgacgacgaagatgacgatgaggatgat gagtag

DBGET integrated database retrieval system