Phycodurus eques (leafy seadragon): 133409326 Help Entry 133409326         CDS       T09682                                  Symbol brk1 Name (RefSeq) probable protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism pee  Phycodurus eques (leafy seadragon) Pathway pee04810   Regulation of actin cytoskeleton pee05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pee00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     133409326 (brk1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     133409326 (brk1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CCDC53 DUF7310 SPX ABC_tran_CTD Hydro_N_hd Matrilin_ccoil LXG Baculo_PEP_C Motif Other DBs NCBI-GeneID:  133409326 NCBI-ProteinID:  XP_061545156 LinkDB All DBs Position 10:complement(20128234..20133819) Genome browser AA seq 75 aa AA seqDB search MAGQEDPVQREIHQDWANREYIEVITSSIKKITDFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggccggtcaggaagatccagtgcagcgagaaattcaccaagattgggccaaccgggag tacatcgaagtaatcacgagcagcatcaagaaaattaccgacttccttaactctttcgac atgtcatgtcgatcccgtttggctaccctcaatgagaagctgacagccttggagaggagg attgaatacattgaagcaagagtgacaaaaggagagaccttgacttaa

DBGET integrated database retrieval system