Phycodurus eques (leafy seadragon): 133411848 Help Entry 133411848         CDS       T09682                                  Symbol ccl25a Name (RefSeq) C-C motif chemokine 25   KO K13072   C-C motif chemokine 25 Organism pee  Phycodurus eques (leafy seadragon) Pathway pee04060   Cytokine-cytokine receptor interaction pee04672   Intestinal immune network for IgA production Brite KEGG Orthology (KO) [BR:pee00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     133411848 (ccl25a)  09150 Organismal Systems   09151 Immune system    04672 Intestinal immune network for IgA production     133411848 (ccl25a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pee04052]     133411848 (ccl25a) Cytokines and neuropeptides [BR:pee04052]  Cytokines   Chemokines    133411848 (ccl25a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 VPR FST_N Motif Other DBs NCBI-GeneID:  133411848 NCBI-ProteinID:  XP_061550565 LinkDB All DBs Position 13:19055436..19058427 Genome browser AA seq 108 aa AA seqDB search MRLETPLILLVLSCLSLAMAQVSYDDCCLTYVKELTKRIRERAVKYRIQETDGGCNIRAV IFTMRKGRMYCCDPQETWVQELMSSIYEKAVKHIKKTSPKHQRRRLFG NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgcgtttggaaacaccgctcatcctcttggtcttatcttgcctgagcctggcgatggca caagtgtcctacgacgactgctgcctgacgtacgtgaaagagctcactaaaaggattcgg gagcgtgcggtcaagtacagaattcaggagacggatggaggctgcaacatccgcgctgtc atcttcaccatgcggaaaggccgcatgtactgctgtgacccgcaagagacgtgggtgcag gagcttatgtccagcatctacgagaaggccgtcaaacacatcaagaagacctccccaaag caccagagacgtcgtctgtttggctga

DBGET integrated database retrieval system