Phycodurus eques (leafy seadragon): 133411944 Help Entry 133411944         CDS       T09682                                  Symbol rheb Name (RefSeq) GTP-binding protein Rheb   KO K07208   Ras homolog enriched in brain Organism pee  Phycodurus eques (leafy seadragon) Pathway pee04140   Autophagy - animal pee04150   mTOR signaling pathway pee04218   Cellular senescence pee04910   Insulin signaling pathway pee05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:pee00001]  09130 Environmental Information Processing   09132 Signal transduction    04150 mTOR signaling pathway     133411944 (rheb)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     133411944 (rheb)   09143 Cell growth and death    04218 Cellular senescence     133411944 (rheb)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     133411944 (rheb)  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     133411944 (rheb)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:pee04031]     133411944 (rheb) GTP-binding proteins [BR:pee04031]  Small (monomeric) G-proteins   Ras Family    Rheb     133411944 (rheb) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 SRPRB RsgA_GTPase AAA_14 Reovirus_M2 RhoGAP_pG1_pG2 STIV_penton_2nd ParE_toxin YebF Motif Other DBs NCBI-GeneID:  133411944 NCBI-ProteinID:  XP_061550796 LinkDB All DBs Position 13:18088224..18098441 Genome browser AA seq 184 aa AA seqDB search MPQPKSRKLAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKMITINGQEYHLQLVD TAGQDEYSIFPQTYSIDINGYILVYSVTSNKSFEVVQVIHEKLLDMVGKVQVPIMLVGNK NDLHMERVISCEEGKALADSWNAAFMESSAKENQTAVEVFRRMILEAEKMDGGAQPGKTS CSVM NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgccgcagcctaagtcacgaaagctcgccatcctcggctaccgatccgtaggaaaatcc tctttgaccattcagttcgttgagggccagtttgttgactcctatgaccccacaatagaa aacacgtttactaaaatgatcacgataaacggacaggagtatcatcttcagctagtcgac acagcaggacaggatgagtactccatctttccacagacgtactccatagatatcaacggc tacatcctggtctattctgtcacttccaataagagctttgaagtggtccaagtgatccac gaaaaactgctggacatggtggggaaagttcaagttcccatcatgctcgtcggaaacaag aacgacctgcacatggagcgggtaatcagctgcgaagaggggaaagcattagccgactcc tggaacgctgccttcatggaatcctcagccaaagagaaccagacggccgtggaggttttc cgcagaatgatcttggaggcggagaagatggacggcggcgcacagcccggcaagacgtcc tgctctgtcatgtag

DBGET integrated database retrieval system