Phycodurus eques (leafy seadragon): 133418239 Help Entry 133418239         CDS       T09682                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism pee  Phycodurus eques (leafy seadragon) Pathway pee04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:pee00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     133418239  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pee04121]     133418239    03400 DNA repair and recombination proteins [BR:pee03400]     133418239 Ubiquitin system [BR:pee04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      133418239    Cul5 complex      133418239 DNA repair and recombination proteins [BR:pee03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      133418239 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  133418239 NCBI-ProteinID:  XP_061562701 LinkDB All DBs Position 19:complement(4160082..4162879) Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRQKTTIFTDAKESTTVYELKRIVEGILKRPPEDQRLYKDDQLLEDIKTLGDS GFTNQTARPQAPATVGLAFRISDEMFEQLHIEAFSSPPELPDVMKPQDSGSTASEQAVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgtgttcttaatgatccggcgtcaaaagaccaccatcttcaccgatgccaaggag tccaccacagtctatgaactaaagcgcatagtcgagggaattctaaagagaccacccgag gaccagcggctctacaaagacgatcagttgctagaggacatcaaaactctgggtgacagc ggattcaccaaccagaccgccagaccacaggcaccggctacagttgggctggctttccga atcagtgatgagatgtttgagcagctgcacatcgaggccttctccagccccccagagctc cccgatgtgatgaagcctcaggactccggtagcactgccagtgaacaggccgtgcagtga

DBGET integrated database retrieval system