Syntrophotalea acetylenivorans: A7E78_01840 Help Entry A7E78_01840       CDS       T04594                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pef  Syntrophotalea acetylenivorans Pathway pef01100   Metabolic pathways pef01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pef00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A7E78_01840    00074 Mycolic acid biosynthesis     A7E78_01840   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A7E78_01840 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 DUF1896 Ribosomal_L12_N Guanylate_cyc DUF1493 Motif Other DBs NCBI-ProteinID:  APG26710 UniProt:  A0A1L3GLD4 LinkDB All DBs Position 406532..406765 Genome browser AA seq 77 aa AA seqDB search MASIEEKVKQIVAEQLGVEEDQVTAEAAFMDDLGADSLDTVELVMALEEEFDIEISDEDA EKIATVGDAISYIADNS NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcttctattgaggaaaaagtcaagcaaattgtagcagagcaacttggagttgaagaa gatcaggtgaccgcggaagctgctttcatggacgacctgggtgctgactcgctcgatacc gttgagctggttatggctttggaagaggaattcgatatcgaaatttccgatgaagatgcc gagaagatcgctactgttggggatgcaatttcctatattgcagataactcctga

DBGET integrated database retrieval system