Syntrophotalea acetylenivorans: A7E78_10020 Help Entry A7E78_10020       CDS       T04594                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism pef  Syntrophotalea acetylenivorans Pathway pef00362   Benzoate degradation pef00621   Dioxin degradation pef00622   Xylene degradation pef01100   Metabolic pathways pef01120   Microbial metabolism in diverse environments pef01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:pef00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     A7E78_10020    00622 Xylene degradation     A7E78_10020    00621 Dioxin degradation     A7E78_10020 Enzymes [BR:pef01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      A7E78_10020 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 MIF Motif Other DBs NCBI-ProteinID:  APG28150 UniProt:  A0A1L3GQL7 LinkDB All DBs Position complement(2201556..2201768) Genome browser AA seq 70 aa AA seqDB search MPVITLAISPQGKDVKEQLISRLTAAAAEATGIPAAKFVVFIDETPRENIGVGGLPLDQA MALQAAGDKP NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgccggtcattaccctcgccatctccccccaggggaaagacgttaaagaacagcttatt tctcgcctcacggctgccgccgccgaagccacgggcattccggcggccaagttcgtggtc tttatcgatgagacgccccgggaaaatatcggcgtcggcggcctgcctctcgatcaggcc atggcgttacaggcagctggcgacaaaccataa

DBGET integrated database retrieval system