Syntrophotalea acetylenivorans: A7E78_10100 Help Entry A7E78_10100       CDS       T04594                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism pef  Syntrophotalea acetylenivorans Pathway pef03060   Protein export pef03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:pef00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     A7E78_10100  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     A7E78_10100  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:pef02044]     A7E78_10100 Secretion system [BR:pef02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    A7E78_10100 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  APG28165 UniProt:  A0A1L3GQI5 LinkDB All DBs Position 2222242..2222481 Genome browser AA seq 79 aa AA seqDB search MFNLGMTEILIILGVALLVLGPKRLPELAQALGKGLAEFKRATSDLHVTLDEPGEPGEID ESVEDSQTEKTSKDPDDHG NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgttcaatctcggcatgaccgaaatccttatcattcttggcgtagcgctgctggtgctc ggccctaaaaggctgcctgaactggctcaagccctgggcaaaggcctggccgaattcaag cgcgccaccagcgatctgcacgtgaccctcgatgagccgggcgaaccgggagagatcgac gaatccgtcgaagattcgcagaccgaaaagacctcgaaagaccccgatgaccatggatga

DBGET integrated database retrieval system