Phycicoccus endophyticus: H9L10_04605 Help Entry H9L10_04605       CDS       T06776                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pei  Phycicoccus endophyticus Pathway pei01100   Metabolic pathways pei01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pei00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H9L10_04605    00074 Mycolic acid biosynthesis     H9L10_04605   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H9L10_04605 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QNN50316 UniProt:  A0A7G9R3Z1 LinkDB All DBs Position complement(953885..954130) Genome browser AA seq 81 aa AA seqDB search MADQQEILSGLAEIVNEETGLDPAEVQMDKSFTDDLDIDSLSMMTIVVNAEEKFGVRIPD DEVKNLATVGDAVGYIQSNQG NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggcagaccagcaggagatcctcagcggcctcgcggagatcgtcaacgaggagaccggg ctggacccggccgaggtccagatggacaagtccttcaccgacgacctcgacatcgactcc ctctcgatgatgaccatcgtcgtcaacgcggaggagaagttcggcgtgcgcatccccgac gacgaggtcaagaacctcgcgacggtcggtgacgccgtggggtacatccagagcaaccag ggctga

DBGET integrated database retrieval system