Phycicoccus endophyticus: H9L10_09220 Help Entry H9L10_09220       CDS       T06776                                  Name (GenBank) NrdH-redoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism pei  Phycicoccus endophyticus Brite KEGG Orthology (KO) [BR:pei00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     H9L10_09220 Enzymes [BR:pei01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      H9L10_09220 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 Thioredoxin_2 Glrx-like GST_N_3 Thioredoxin Motif Other DBs NCBI-ProteinID:  QNN48510 UniProt:  A0A7G9QYT5 LinkDB All DBs Position 1917683..1917943 Genome browser AA seq 86 aa AA seqDB search MSDPTPPPAGSVTMFSTSWCGFCARLRSGLERAGIPFTEVDIDRRPDGADFVVLANRGDR TVPTVLFPDGTHATNPSLAEVRERLG NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgagcgaccccaccccacccccggccggttcggtgacgatgttctccacctcgtggtgc gggttctgcgcccggctcaggtcgggcctggagcgcgccggcatcccgttcaccgaggtc gacatcgaccgccggcccgacggcgcggacttcgtcgtgctcgccaaccgcggcgaccgc acggttcccaccgtcctcttccccgacggcacgcacgccaccaacccctcgctcgccgag gtgcgcgagcggctgggctga

DBGET integrated database retrieval system