Candidatus Pelagibacter sp. IMCC9063: SAR11G3_00696 Help Entry SAR11G3_00696     CDS       T01465                                  Name (GenBank) ATP synthase C chain   KO K02110   F-type H+-transporting ATPase subunit c Organism pel  Candidatus Pelagibacter sp. IMCC9063 Pathway pel00190   Oxidative phosphorylation pel01100   Metabolic pathways Module pel_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:pel00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     SAR11G3_00696  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:pel00194]     SAR11G3_00696 Photosynthesis proteins [BR:pel00194]  Photosystem and electron transport system   F-type ATPase [OT]    SAR11G3_00696 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  AEA81171 UniProt:  F2I0G6 LinkDB All DBs Position complement(614626..614853) Genome browser AA seq 75 aa AA seqDB search MEVEAAKMIGAGIACIALAGAGLGIGNIFGSYLSAAMRNPSAAQKQFPNLLLGFALAEAT GLFGLVVALIILFAF NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggaagtagaagcagcaaaaatgatcggggcaggaatagcctgcatagcattggcggga gctggattgggtatcggaaatatttttggtagctatctatctgcagcaatgagaaaccca tctgcagcacaaaaacaattccctaatttattgttgggatttgcacttgctgaagcaact ggcctatttggtttggttgttgcattaattatacttttcgctttttaa

DBGET integrated database retrieval system