Paenibacillus elgii: ACJ7K1_07415 Help Entry ACJ7K1_07415      CDS       T11011                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pelg  Paenibacillus elgii Pathway pelg00998   Biosynthesis of various antibiotics pelg01100   Metabolic pathways pelg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pelg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ACJ7K1_07415    00074 Mycolic acid biosynthesis     ACJ7K1_07415   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ACJ7K1_07415 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  XOK62940 LinkDB All DBs Position 1728602..1728850 Genome browser AA seq 82 aa AA seqDB search MKPIMETVKETLSAYLSIKPEEIGEEDRLYESLGIDSAAIVSLLLELEQACGVAFDLEEL TPEHLASVRSLSLTIQALKDDE NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgaagccgattatggagacggtcaaagaaacgcttagcgcttatttatccatcaagccg gaggaaatcggggaggaggaccggctgtacgagagcctgggcatcgattcggcggcgatc gtttcgctgctgctcgaattggaacaggcgtgcggcgtcgcgttcgatctggaggagctg acccctgaacatttggcgtcggtccgaagcctgtccttgacgatccaggcattgaaagac gacgaataa

DBGET integrated database retrieval system