Paenibacillus elgii: ACJ7K1_07630 Help Entry ACJ7K1_07630      CDS       T11011                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pelg  Paenibacillus elgii Pathway pelg00998   Biosynthesis of various antibiotics pelg01100   Metabolic pathways pelg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pelg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ACJ7K1_07630    00074 Mycolic acid biosynthesis     ACJ7K1_07630   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ACJ7K1_07630 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  XOK62983 LinkDB All DBs Position 1766262..1766525 Genome browser AA seq 87 aa AA seqDB search MERNQEALKRRLVELAFEITGEGELGEDQDYDVYLTSPLPELGVDSLTALELAVHLEREF GTRLEEQELTQIRTLEDIVRFVEAKGD NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggaacggaatcaggaagctttgaagagacgcttggtcgagctggcatttgaaattacc ggagaaggggagctcggcgaagaccaggattacgacgtttacttaacttcgccgctgccc gagctaggggtcgattcgctaacggcgcttgagctggccgtgcacctggagcgcgaattc gggacccgcctggaggagcaggagctgacgcagattcgcacgctggaggacatcgtccgg tttgtcgaagctaaaggagactaa

DBGET integrated database retrieval system